PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LPERR08G12960.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Leersia
Family MYB
Protein Properties Length: 356aa    MW: 39724.4 Da    PI: 6.6462
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LPERR08G12960.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding56.47e-181461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd++l+ +++++G g+W++ +++ g+ R++k+c++rw +yl
  LPERR08G12960.1 14 KGPWTPEEDQKLLAYIEEHGHGSWRALPSKAGLQRCGKSCRLRWTNYL 61
                     79********************************************97 PP

2Myb_DNA-binding537.7e-1767112148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg+++ +E++ +++++++lG++ W++Ia +++ +Rt++++k++w+++l
  LPERR08G12960.1  67 RGKFSLQEEQTIIQLHALLGNR-WSAIATHLP-KRTDNEIKNYWNTHL 112
                      89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.606.4E-26564IPR009057Homeodomain-like
PROSITE profilePS5129417.764961IPR017930Myb domain
SuperFamilySSF466891.35E-3011108IPR009057Homeodomain-like
SMARTSM007171.6E-141363IPR001005SANT/Myb domain
PfamPF002491.2E-161461IPR001005SANT/Myb domain
CDDcd001673.29E-111661No hitNo description
PROSITE profilePS5129425.89162116IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.4E-2665116IPR009057Homeodomain-like
SMARTSM007171.2E-1666114IPR001005SANT/Myb domain
PfamPF002494.1E-1667112IPR001005SANT/Myb domain
CDDcd001673.77E-1169112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009733Biological Processresponse to auxin
GO:0009739Biological Processresponse to gibberellin
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0010091Biological Processtrichome branching
GO:0046686Biological Processresponse to cadmium ion
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 356 aa     Download sequence    Send to blast
MGRSPCCEKI GLKKGPWTPE EDQKLLAYIE EHGHGSWRAL PSKAGLQRCG KSCRLRWTNY  60
LRPDIKRGKF SLQEEQTIIQ LHALLGNRWS AIATHLPKRT DNEIKNYWNT HLKKRLAKMG  120
IDPVTHKAIN GTLNSTAGDK SAKVTASLSH MAQWESARLE AEARLARESK MRIAASTPSK  180
LHGHSNNPPA STSPCFEVLI AWQSAKIDLE SPTSTLTFTG SNASMMPFSM TTGLELSESN  240
SHAWQQRNDE LEGEESEWKF ISKQQLQGLD SKETEEHFID CEESWFPGTS NIGPGFTGML  300
LDGSNVHDTS ECWGESNNGQ DEQRSQASGD AENKNYWNGI FSMVNSEQPP QPSPLL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-26121165108B-MYB
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAJ4957960.0AJ495796.1 Oryza sativa Japonica Group mRNA for MYB27 protein.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015650319.10.0PREDICTED: myb-related protein 308
TrEMBLA0A0D9X8580.0A0A0D9X858_9ORYZ; Uncharacterized protein
STRINGLOC_Os08g33660.10.0(Oryza sativa Japonica Group)
STRINGBGIOSGA026935-PA0.0(Oryza sativa Indica Group)
STRINGORGLA08G0137800.10.0(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP56093758
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G15310.11e-100myb domain protein 16